cyclotide c1 precursor(79) Protein Card

General Information
Name cyclotide c1 precursor
Sequence
MEMKNMVVGLFLIAAFALPALAT
NFEKDFITHETVQAILK
KVGPSSNGMLDEQTISALTGKTIISN
PVLEEALLTHSNSI
NALG
GTLPCGESCVWIPCISSVVGCSCKSKVCYKN
SLA
Class Cyclotide
Average Mass 12470.59
Monoisotopic Mass 12462.29
m/z M+H 12463.3
ProteinType Precursor
Parent
Organism Viola odorata
Notes Precursor protein
Cyclic No

Assay
No assays found

References
Dutton JL, Renda RF, Waine C, Clark RJ, Daly NL, Jennings CV, Anderson MA, Craik DJ (2004) Conserved structural and sequence elements implicated in the processing of gene-encoded circular proteins. J Biol Chem 279:46858-67

Cross-references
Domains cycloviolacin O8 (27)
Nucleic acids cyclotide c1 precursor
Structure
Links GenBank AAU04393.1
SwissProt Q5USN9

Tools