vigno 8(789) Protein Card

General Information
Name vigno 8
Sequence GIPCGESCVWIPCITSAVGCSCKSKVCYRN
Class Cyclotide
Average Mass 3140.69
Monoisotopic Mass 3138.37
m/z M+H 3140.69
ProteinType Wild type
Parent
Organism Viola ignobilis
Notes
Cyclic Yes

Assay
No assays found

References
Hashempour,H., Koehbach,J., Daly,N.L., Ghassempour,A. and Gruber,C.W. (2013) Characterizing circular peptides in mixtures: sequence fragment assembly of cyclotides from a violet plant by MALDI-TOF/TOF mass spectrometry. Amino Acids 44:581-595

Cross-references
Nucleic acids
Structure
Links

Tools