cyclotide c3 precursor(78) Protein Card

General Information
Name cyclotide c3 precursor
Sequence
MDAKKMFVALVLIATFALPSLAT
FEKDFITPETIQAILKK
SAPLSNIMLEEDVINALLKSKTVISN
PIIEEAFLKNSNGL
N
GIPCGESCVWIPCISAAIGCSCKSKVCYRN
SLDN
Class Cyclotide
Average Mass 12432.65
Monoisotopic Mass 12424.41
m/z M+H 12425.41
ProteinType Precursor
Parent
Organism Viola odorata
Notes Precursor protein
Cyclic No

Assay
No assays found

References
Dutton JL, Renda RF, Waine C, Clark RJ, Daly NL, Jennings CV, Anderson MA, Craik DJ (2004) Conserved structural and sequence elements implicated in the processing of gene-encoded circular proteins. J Biol Chem 279:46858-67

Cross-references
Domains cycloviolacin O13 (170)
Nucleic acids cyclotide c3 precursor
Structure
Links GenBank AAU04394.1
SwissProt Q5USN8

Tools