Cter B precursor(769) Protein Card

General Information
Name Cter B precursor
Alternative name(s) cliotide T14
Sequence
MGTIARYYAHVVLFLVATSVIFTVKKTEA
GVPCAESCVWI
PCTVTALLGCSCKDKVCYLN
HVIAFEAKTMD
EHHLLCQSH
EDCYKKGSGNFCAPFFNHDVKYGWCFRAEFEGYLLKDFLK
MQPRDILKISKAIAK
Class Cyclotide
Average Mass 15249.93
Monoisotopic Mass 15239.56
m/z M+H 15240.57
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Domains Cter B (478)
Nucleic acids Clitoria ternatea cyclotide precursor cter B mRNA, complete cds
Structure
Links SwissProt G1CWI0

Tools