Cter A precursor(768) Protein Card

General Information
Name Cter A precursor
Alternative name(s) cliotide 13
Sequence
MASLRIAPFALFLFLAASVMFAVEKTEA
GVIPCGESCVFI
PCISTVIGCSCKNKVCYRN
HIIAAEAKTMD
EHILLCQSHE
DCIAKGTGNFCAPFPDQDIKYGWCFRAESEGFMLKDHLKM
SITN
Class Cyclotide
Average Mass 13644.02
Monoisotopic Mass 13634.58
m/z M+H 13635.59
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Domains Cter A (477)
Nucleic acids Clitoria ternatea cyclotide precursor cter A mRNA, complete cds
Structure
Links

Tools