cliotide T12 precursor(767) Protein Card

General Information
Name cliotide T12 precursor
Sequence
MASLRIAPLALFFFLAASVMFTVEKTEA
GIPCGESCVFIP
CITGAIGCSCKSKVCYRD
HVIAAEAKTMD
DHHLLCQSHED
CITKGTGNFCASFPEQDIKYGWCFRAESEGFMLKDHLKMS
VPN
Class Cyclotide
Average Mass 13502.72
Monoisotopic Mass 13493.39
m/z M+H 13494.4
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Domains cliotide T12 (766)
Nucleic acids Clitoria ternatea cyclotide precursor cliotide T12 mRNA, complete cds
Structure
Links SwissProt G1CWH8

Tools