cliotide T12(766) Protein Card

General Information
Name cliotide T12
Alternative name(s) cT12
Sequence GIPCGESCVFIPCITGAIGCSCKSKVCYRD
Class Cyclotide
Technique NGS,MS,PcR
Average Mass 3086.64
Monoisotopic Mass 3084.35
m/z M+H 3086.64
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Protein precursor(s) cliotide T12 precursor
Nucleic acids Amanita bisporigera alpha-amanitin (AMA1) mRNA, complete cds
Structure
Links SwissProt G1CWH8

Tools