cliotide T2(765) Protein Card

General Information
Name cliotide T2
Sequence GEFLKCGESCVQGECYTPGCSCDWPICKKN
Class Cyclotide
Technique NGS,MS,PcR
Average Mass 3261.70
Monoisotopic Mass 3259.3
m/z M+H 3261.7
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Observed PTMs: oxidation W24, de-amidation Q12 & N30. (Serra et al., 2016) Highly expressed in C. ternatea shoot, flower and pod. (Gilding et al., 2016)
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) cliotide T2 precursor
Nucleic acids
Structure
Links SwissProt G1CWH1

Tools