cliotide T9 precursor [partial](763) Protein Card

General Information
Name cliotide T9 precursor [partial]
Sequence
MAYVRLACLAVIFFFAASVMFTVEA
GIPCGESCVFIPCLT
TVVGCSCKNKVCYNN
HVIAA EANSI
DDHHLLCQSHDDCI
KKGTGNFCAPFLDHAVQYGWCFRAESEGYLLKDFLKM
P
Class Cyclotide
Average Mass 6397.71
Monoisotopic Mass 6393.11
m/z M+H 6394.12
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Domains cliotide T9 (762)
Nucleic acids Clitoria ternatea cyclotide precursor cliotide T9 mRNA, complete cds
Structure
Links SwissProt G1CWH7

Tools