cliotide T9(762) Protein Card

General Information
Name cliotide T9
Sequence GIPCGESCVFIPCLTTVVGCSCKNKVCYNN
Class Cyclotide
Technique NGS,MS,PcR
Average Mass 3128.68
Monoisotopic Mass 3126.36
m/z M+H 3128.68
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Highly expressed in C. ternatea seed. (Gilding et al., 2016)
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) cliotide T9 precursor [partial]
Nucleic acids
Structure
Links SwissProt G1CWH7

Tools