Cter R precursor(760) Protein Card

General Information
Name Cter R precursor
Alternative name(s) cliotide T7
Sequence
MAFARLALIFFLAASVMFAVKETEA
GIPCGESCVFIPCTV
TALLGCSCKDKVCYKN
HVIA AEANTV
NDHHLLCQSHEDC
FKKGTGNFCAPSLKHDVKYGWCFRAESEGFLLKDFLKTPV
D ILKMSNVI
GN
Class Cyclotide
Average Mass 6403.74
Monoisotopic Mass 6399.21
m/z M+H 6400.22
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Domains Cter R (600)
Nucleic acids Clitoria ternatea cyclotide precursor cliotide T7 mRNA, complete cds
Structure
Links SwissProt G1CWH5

Tools