kalata B1 precursor(76) Protein Card

General Information
Name kalata B1 precursor
Sequence
MAKFTVCLLLCLLLAAFVGAFGS
ELSDSHKTTLVNEIAEK
MLQRKILDGVEATLVTDVAEKMFLRKMKAEA
KTSETADQV
FLKQLQLK
GLPVCGETCVGGTCNTPGCTCSWPVCTRN
GLP
SLAA
Class Cyclotide
Average Mass 13262.61
Monoisotopic Mass 13253.72
m/z M+H 13254.72
ProteinType Precursor
Parent
Organism Oldenlandia affinis
Notes Precursor protein
Cyclic No

Assay
No assays found

References
Jennings C, West J, Waine C, Craik D, Anderson M (2001) Biosynthesis and insecticidal properties of plant cyclotides: the cyclic knotted proteins from Oldenlandia affinis. Proc Natl Acad Sci U S A 98:10614-9

Cross-references
Domains kalata B1 (1)
Nucleic acids kalata B1 precursor [OaK1]
Structure
Links GenBank P56254.3
SwissProt P56254

Tools