cliotide T8(759) Protein Card

General Information
Name cliotide T8
Sequence GIPCGESCVFIPCISSVVGCSCKSKVCYNN
Class Cyclotide
Technique NGS,MS,PcR
Average Mass 3073.60
Monoisotopic Mass 3071.31
m/z M+H 3073.6
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0

Cross-references
Protein precursor(s) cliotide T8 precursor
Nucleic acids
Structure
Links SwissProt G1CWH6

Tools