cliotide T8(759) Protein Card

General Information
Name cliotide T8
Sequence GIPCGESCVFIPCISSVVGCSCKSKVCYNN
Class Cyclotide
Technique MS,PcR,NGS
Average Mass 3073.60
Monoisotopic Mass 3071.31
m/z M+H 3073.6
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Was detected in <i> C. ternatea pod and stem by NGS and in <i> C. ternatea stem, leaf, pod and flower by MS (Kalmankar et al., 2020).
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Kalmankar,N.V., Venkatesan,R., Balaram,P. and Sowdhamini,R. (2020) Transcriptomic profiling of the medicinal plant Clitoria ternatea: identification of potential genes in cyclotide biosynthesis. Sci Rep 10:12658-0

Cross-references
Protein precursor(s) cliotide T8 precursor
cliotide T8 precursor
cliotide T8 precursor
Nucleic acids
Structure
Links SwissProt G1CWH6

Tools