cliotide T8 precursor(758) Protein Card

General Information
Name cliotide T8 precursor
Sequence
MAYVRLACLAVIFFFAASVMFTVEA
GIPCGESCVFIPCIS
SVVGCSCKSKVCYNN
HVIAAEANSVD
DHHLLCQSHDDCIK
KGTGNFCAPFLDHAVQYGWCFRAESEGYLLKDFLKMPKAL
TN
Class Cyclotide
Average Mass 13336.52
Monoisotopic Mass 13327.33
m/z M+H 13328.34
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Domains cliotide T8 (759)
Nucleic acids Clitoria ternatea cyclotide precursor cliotide T8 mRNA, complete cds
Structure
Links SwissProt G1CWH6

Tools