Cter A or Cter Q precursor [partial](757) Protein Card

General Information
Name Cter A or Cter Q precursor [partial]
Alternative name(s) cliotide T5
Sequence
IPCGESCVFIPCISTVIGCSCKN
KVCYRNHVIAAEAKTMD
DHHLLCQSHEDCITKGTGNFCAPFPDQDIKYGWCFRAESE
GFMLKDHLKMSITN
Class Cyclotide
Average Mass 10486.11
Monoisotopic Mass 10478.82
m/z M+H 10479.83
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes Ambiguities regarding which peptide, Cter A or Cter Q, result from processing this partial precursor as the beginning of the cyclotide domain is missing.
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Domains Cter Q (599)
Cter A (477)
Nucleic acids Clitoria ternatea cyclotide precursor cliotide T5 mRNA, partial cds
Structure
Links SwissProt G1CWH4

Tools