Cter P precursor (variant) [partial](756) Protein Card

General Information
Name Cter P precursor (variant) [partial]
Alternative name(s) cliotide T1
Sequence
IPCGESCVFIPCITGAIGCSCKSKVCYRN
HVIAAEAKTMD
DHHLLCQSHEDCITKGTGNFCAPFPDQDIKYGWCFRAESE
GFMLKDHLKMSITN
Class Cyclotide
Average Mass 10401.00
Monoisotopic Mass 10393.77
m/z M+H 10394.78
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes Partial precursor most probably corresponding to Cter P (first Gly missing)
Cyclic Yes

Assay
No assays found

References
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Domains Cter P (598)
Nucleic acids Clitoria ternatea cyclotide precursor cliotide T1 mRNA, partial cds
Structure
Links SwissProt G1CWH0

Tools