viphi A(748) Protein Card

General Information
Name viphi A
Sequence GSIPCGESCVFIPCISSVIGCACKSKVCYKN
Class Cyclotide
Average Mass 3172.77
Monoisotopic Mass 3170.42
m/z M+H 3171.43
ProteinType Wild type
Parent
Organism Viola philippica
Notes
Cyclic Yes

Assay
No assays found

References
He,W., Chan,L.Y., Zeng,G., Daly,N.L., Craik,D.J. and Tan,N. (2011) Isolation and characterization of cytotoxic cyclotides from Viola philippica. Peptides 32:1719-1723

Cross-references
Nucleic acids
Structure
Links

Tools