Parigidin-br1(744) Protein Card

General Information
Name Parigidin-br1
Sequence GGSVPCGESCVFIPCITSLAGCSCKNKVCYYD
Class Cyclotide
Average Mass 3280.78
Monoisotopic Mass 3278.37
m/z M+H 3279.38
ProteinType Wild type
Parent
Organism Palicourea rigida
Notes
Cyclic Yes

Assay
No assays found

References
Pinto,M.F., Fensterseifer,I.C., Migliolo,L., Sousa,D.A., de Capdville,G., Arboleda-Valencia,J.W., Colgrave,M.L., Craik,D.J., Magalhães,B.S., Dias,S.C. and Franco,O.L. (2012) Identification and structural characterization of novel cyclotide with activity against an insect pest of sugar cane. J. Biol. Chem. 287:134-147

Cross-references
Nucleic acids
Structure
Links SwissProt B3EWF1

Tools