cycloviolin D(70) Protein Card

General Information
Name cycloviolin D
Sequence GFPCGESCVFIPCISAAIGCSCKNKVCYRN
Class Cyclotide
Average Mass 3146.70
Monoisotopic Mass 3144.36
m/z M+H 3145.36
ProteinType Wild type
Parent
Organism Leonia cymosa
Notes
Cyclic Yes

Assay
Anti-HIV
Cycloviolins A-D shown to possess anti-HIV activity. [...]Hallock YF et al. (2000) J Org Chem 65:124-8

References
Hallock YF, Sowder RC 2nd, Pannell LK, Hughes CB, Johnson DG, Gulakowski R, Cardellina JH 2nd, Boyd MR (2000) Cycloviolins A-D, anti-HIV macrocyclic peptides from Leonia cymosa. J Org Chem 65:124-8

Cross-references
Nucleic acids
Structure
Links GenBank P84640.1
SwissProt P84640

3D models Download or view with Jmol

Tools