Cter M precursor(614) Protein Card

General Information
Name Cter M precursor
Alternative name(s) cliotide T3
Sequence
MAYVRLTSLAVLFFLAASVMKTEG
GLPTCGETCTLGTCYV
PDCSCSWPICMKN
HIIAANAKTV
NEHRLLCTSHEDCFKKG
TGNYCASFPDSNIHFGWCFHAESEGYLLKDFMNMSKD
DLK
MPLESTN
Class Cyclotide
Average Mass 14078.22
Monoisotopic Mass 14068.52
m/z M+H 14069.52
ProteinType Precursor
Parent
Organism Clitoria ternatea L
Notes Also in Uniprot/Trembl G1CWH2
Cyclic No

Assay
No assays found

References
Poth AG, Colgrave ML, Lyons RE, Daly NL, Craik DJ (2011) Discovery of an unusual biosynthetic origin for circular proteins in legumes Proc Natl Acad Sci USA 108:10127-10132
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287

Cross-references
Domains Cter M (595)
Nucleic acids Clitoria ternatea cyclotide M precursor, mRNA, complete cds.
Clitoria ternatea cyclotide precursor cliotide T3 mRNA, complete cds
Structure
Links SwissProt P86899

Tools