hedyotide B1(613) Protein Card

General Information
Name hedyotide B1
Sequence GTRCGETCFVLPCWSAKFGCYCQKGFCYRN
Class Cyclotide
Average Mass 3404.94
Monoisotopic Mass 3402.41
m/z M+H 3403.42
ProteinType Wild type
Parent
Organism Hedyotis biflora
Notes
Cyclic Yes

Assay
No assays found

References
Wong CT, Taichi M, Nishio H, Nishiuchi Y, Tam JP (2011) Optimal Oxidative Folding of the Novel Antimicrobial Cyclotide from Hedyotis biflora Requires High Alcohol Concentrations. Biochemistry [ahead]:0-0
Nguyen,G.K., Zhang,S., Wang,W., Wong,C.T., Nguyen,N.T. and Tam,J.P. (2011) Discovery of a linear cyclotide from the bracelet subfamily and its disulfide mapping by top-down mass spectrometry. J. Biol. Chem. 286:44833-44844

Cross-references
Protein precursor(s) hedyotide B1 precursor
Nucleic acids
Structure
Links SwissProt G9I0X2

Tools