PawS1 - annuus(612) Protein Card

General Information
Name PawS1 - annuus
Sequence
MAKLIILVVLAILAFVEVSVS
GYKTSISTITIEDN
GRCTK
SIPPICFPD
GLDN
PRGCQIRIQQLNHCQMHLTSFDYK
LRM
AVEN
PKQQQHLSLCCNQLQEVEKQCQCEAIKQVVEQAQKQ
LQQGQGGQQQVQQMVKKAQMLPNQCNLQCSI
Class BBI-like trypsin inhibitor
Average Mass 16999.82
Monoisotopic Mass 16988.57
m/z M+H 16989.57
ProteinType Precursor
Parent
Organism Helianthus annus
Notes
Cyclic No

Assay
No assays found

References
Mylne JS, Colgrave ML, Daly NL, Chanson AH, Elliott AG, McCallum EJ, Jones A, Craik DJ. (2011) Albumins and their processing machinery are hijacked for cyclic peptides in sunflower. Nat Chem Biol 7:257-259

Cross-references
Domains SFTI-1 (81)
Nucleic acids Helianthus annuus preproalbumin PawS1 (PawS1) mRNA, complete cds
Helianthus annuus preproalbumin PawS1 (PawS1) gene, complete cds
Structure
Links

Tools