PawS1 - tuberosus(610) Protein Card

General Information
Name PawS1 - tuberosus
Sequence
MAKLITLVVFAMLAFVEVSVS
GYKTSISTITIEDN
GRCTK
SIPPICFPD
GLDN
PIEDNSFRFYPDGLDNPGGCQIRIQQL
NHCQMHLTSFDYK
LRMAVEN
PKQQHLNLCCNQLQEVEKQC
QCEAIKQVVEQAQKQLQQGQGGQQQVQQMVKKAQMLPNQC
NLQCSI
Class BBI-like trypsin inhibitor
Average Mass 18720.57
Monoisotopic Mass 18708.18
m/z M+H 18709.19
ProteinType Precursor
Parent
Organism Helianthus tuberosus
Notes
Cyclic No

Assay
No assays found

References
Mylne JS, Colgrave ML, Daly NL, Chanson AH, Elliott AG, McCallum EJ, Jones A, Craik DJ. (2011) Albumins and their processing machinery are hijacked for cyclic peptides in sunflower. Nat Chem Biol 7:257-259

Cross-references
Domains SFTI-1 (81)
Nucleic acids Helianthus tuberosus clone HT__Ef0001C13 preproalbumin (PawS1) mRNA, complete cds
Structure
Links

Tools