PawS1 - exilis(609) Protein Card

General Information
Name PawS1 - exilis
Sequence
MAKLTFVVLAILAFVQVSVSG
YKTSISTITTIEDN
GRCTK
SIPPICFPD
GLDN
PRGCQIRIQQLNHCQMHLTSFDYK
LRM
AVEN
PKQQQQHLNLCCNQLQQVEKQCQCEAIKQVVEQAQK
QLQQGQGGQQQVQQMVKKAQMLPNQCNLQCS
I
Class BBI-like trypsin inhibitor
Average Mass 17162.92
Monoisotopic Mass 17151.58
m/z M+H 17152.59
ProteinType Precursor
Parent
Organism Helianthus exilis
Notes
Cyclic No

Assay
No assays found

References
Mylne JS, Colgrave ML, Daly NL, Chanson AH, Elliott AG, McCallum EJ, Jones A, Craik DJ. (2011) Albumins and their processing machinery are hijacked for cyclic peptides in sunflower. Nat Chem Biol 7:257-259

Cross-references
Domains SFTI-1 (81)
Nucleic acids Helianthus exilis clone HE_AEc0024A09 preproalbumin (PawS1) mRNA, complete cds
Structure
Links

Tools