vitri F(605) Protein Card

General Information
Name vitri F
Sequence GLTPCGESCVWIPCISSVVGCACKSKVCYKD
Class Cyclotide
Technique MS
Average Mass 3212.79
Monoisotopic Mass 3210.41
m/z M+H 3212.79
ProteinType Wild type
Parent
Organism Viola tricolor
Notes
Cyclic Yes

Assay
No assays found

References
Tang J, Wang CK, Pan X, Yan H, Zeng G, Xu W, He W, Daly NL, Craik DJ, Tan N (2010) Isolation and characterization of cytotoxic cyclotides from Viola tricolor. Peptides 31:1434-1440
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862

Cross-references
Nucleic acids
Structure
Links

Tools