Cter R(600) Protein Card

General Information
Name Cter R
Alternative name(s) cliotide T7
Sequence GIPCGESCVFIPCTVTALLGCSCKDKVCYKN
Class Cyclotide
Technique PcR,NGS,MS
Average Mass 3228.84
Monoisotopic Mass 3226.45
m/z M+H 3228.84
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Induces upregulation of inflammatory cytokines in THP-1 cells stimulated with LPS. (Nguyen et al., 2016) May exist as a mature linear peptide. (Serra et al., 2016) Observed PTMs: N-terminal acetylation, de-amidation N14, hexosylation S22. (Serra et al., 2016) Highly expressed in C. ternatea root and seed. (Gilding et al. 2016)
Cyclic Yes

Assay
No assays found

References
Poth AG, Colgrave ML, Lyons RE, Daly NL, Craik DJ (2011) Discovery of an unusual biosynthetic origin for circular proteins in legumes Proc Natl Acad Sci USA 108:10127-10132
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Nguyen KN, Nguyen GK, Nguyen PQ, Ang KH, Dedon PC, Tam JP (2016) Immunostimulating and Gram-negative-specific Antibacterial Cyclotides from the Butterfly Pea Clitoria ternatea. FEBS J doi:10.1111/febs.13720:0-0
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0
Gilding,E.K., Jackson,M.A., Poth,A.G., Henriques,S.T., Prentis,P.J., Mahatmanto,T. and Craik,D.J. (2016) Gene coevolution and regulation lock cyclic plant defence peptides to their targets. New Phytol. 210:717-730

Cross-references
Protein precursor(s) Cter R precursor
Nucleic acids
Structure
Links SwissProt P86903

Tools