Cter P(598) Protein Card

General Information
Name Cter P
Alternative name(s) cliotide T4
Sequence GIPCGESCVFIPCITAAIGCSCKSKVCYRN
Class Cyclotide
Technique NGS,MS,PcR
Average Mass 3105.73
Monoisotopic Mass 3103.42
m/z M+H 3104.43
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes Observed PTMs: de-amidation N30. (Serra et al., 2016)
Cyclic Yes

Assay
No assays found

References
Poth AG, Colgrave ML, Lyons RE, Daly NL, Craik DJ (2011) Discovery of an unusual biosynthetic origin for circular proteins in legumes Proc Natl Acad Sci USA 108:10127-10132
Nguyen,G.K., Zhang,S., Nguyen,N.T., Nguyen,P.Q., Chiu,M.S., Hardjojo,A. and Tam,J.P. (2011) Discovery and characterization of novel cyclotides originated from chimeric precursors consisting of albumin-1 chain a and cyclotide domains in the Fabaceae family. J. Biol. Chem. 286:24275-24287
Serra,A., Hemu,X., Nguyen,G.K., Nguyen,N.T., Sze,S.K. and Tam,J.P. (2016) A high-throughput peptidomic strategy to decipher the molecular diversity of cyclic cysteine-rich peptides. Sci Rep 6:23005-0

Cross-references
Protein precursor(s) Cter P precursor (variant) [partial]
Cter P precursor
Nucleic acids
Structure
Links SwissProt P86902

Tools