Cter G(589) Protein Card

General Information
Name Cter G
Sequence GLPCGESCVFIPCITTVVGCSCKNKVCYNN
Class Cyclotide
Technique MS
Average Mass 3128.68
Monoisotopic Mass 3126.36
m/z M+H 3128.68
ProteinType Wild type
Parent
Organism Clitoria ternatea L
Notes
Cyclic Yes

Assay
No assays found

References
Poth AG, Colgrave ML, Philip R, Kerenga B, Daly NL, Anderson MA, Craik DJ (2011) Discovery of cyclotides in the fabaceae plant family provides new insights into the cyclization, evolution, and distribution of circular proteins. ACS Chem Biol 6:345-355

Cross-references
Nucleic acids
Structure
Links SwissProt P86847

Tools