Oak8 cyclotide(575) Protein Card

General Information
Name Oak8 cyclotide
Sequence GVPCGESCVFIPCLTAVVGCSCSNKVCYLN
Class Cyclotide
Technique MS,PcR
Average Mass 3042.58
Monoisotopic Mass 3040.31
m/z M+H 3042.58
ProteinType Wild type
Parent
Organism Viola odorata
Oldenlandia affinis
Notes Oak8 was found in O. affinis by cDNA sequencing (Mylne et al., 2010). It was identified in V. odorata leaf tissue using mass spectrometry (Aslam et al., 2021).
Cyclic Yes

Assay
No assays found

References
Mylne JS, Wang CK, van der Weerden NL, Craik DJ (2010) Cyclotides are a component of the innate defense of Oldenlandia affinis. Biopolymers 94:635-646
Aslam,L., Kaur,R., Sharma,V., Kapoor,N. and Mahajan,R. (2021) Isolation and characterization of cyclotides from the leaves of Viola odorata L. using peptidomic and bioinformatic approach. 3 Biotech 11:211-0

Cross-references
Protein precursor(s) Oak8 precursor
Nucleic acids
Structure
Links

Tools