Oak8 cyclotide(575) Protein Card

General Information
Name Oak8 cyclotide
Sequence GVPCGESCVFIPCLTAVVGCSCSNKVCYLN
Class Cyclotide
Average Mass 3042.58
Monoisotopic Mass 3040.31
m/z M+H 3041.32
ProteinType Wild type
Parent
Organism Oldenlandia affinis
Notes
Cyclic Yes

Assay
No assays found

References
Mylne JS, Wang CK, van der Weerden NL, Craik DJ (2010) Cyclotides are a component of the innate defense of Oldenlandia affinis. Biopolymers 94:635-646

Cross-references
Protein precursor(s) Oak8 precursor
Nucleic acids
Structure
Links

Tools