Oak9 precursor(571) Protein Card

General Information
Name Oak9 precursor
Sequence
VLGVAADKTA
LAEEIAEMLAGVEAFETDLDKTALLTEISD
KMYLRKMLSGVDIEKADKTALAKEISDKMFLRKMLQGGA
G
TSETADKIFKREMENRLT
GSIPCGESCVWIPCITAIAGCS
CSNKVCYR
Class Cyclotide
Average Mass 13875.16
Monoisotopic Mass 13865.96
m/z M+H 13866.97
ProteinType Precursor
Parent
Organism Oldenlandia affinis
Notes Partial cyclotide domain
Cyclic No

Assay
No assays found

References
Mylne JS, Wang CK, van der Weerden NL, Craik DJ (2010) Cyclotides are a component of the innate defense of Oldenlandia affinis. Biopolymers 94:635-646

Cross-references
Nucleic acids OaK9
Structure
Links

Tools