Oak8 precursor(570) Protein Card

General Information
Name Oak8 precursor
Sequence
VLGVAASGHDKTA
LVNEITEMLAGVETFEAKLDKAALVSE
MADKVFLRKMLSGVDIEKADKKALVKEISDKMFLRKMLQG
GT
GTSETADKIFKSEMESRLTG
GVPCGESCVFIPCLTAVV
GCSCSNKVCYLN
ELPPAAVSA
Class Cyclotide
Average Mass 14935.46
Monoisotopic Mass 14925.59
m/z M+H 14926.6
ProteinType Precursor
Parent
Organism Oldenlandia affinis
Notes
Cyclic No

Assay
No assays found

References
Mylne JS, Wang CK, van der Weerden NL, Craik DJ (2010) Cyclotides are a component of the innate defense of Oldenlandia affinis. Biopolymers 94:635-646

Cross-references
Domains Oak8 cyclotide (575)
Nucleic acids OaK8
Structure
Links

Tools