OaK7 precursor(569) Protein Card

General Information
Name OaK7 precursor
Sequence
FLGSVESSEIDAATTTRLMLNEIAEKWYLRKMMSGV
GSSE
TVDKIFKRETNGRLT
GSHCGETCFFFGCYKPGCSCDELRQ
CYKN
ELPPAEESH
Class Cyclotide
Average Mass 10454.81
Monoisotopic Mass 10447.88
m/z M+H 10448.89
ProteinType Precursor
Parent
Organism Oldenlandia affinis
Notes
Cyclic No

Assay
No assays found

References
Mylne JS, Wang CK, van der Weerden NL, Craik DJ (2010) Cyclotides are a component of the innate defense of Oldenlandia affinis. Biopolymers 94:635-646

Cross-references
Domains Oak7 cyclotide (574)
Nucleic acids OaK7
Structure
Links

Tools