kalata B19(563) Protein Card

General Information
Name kalata B19
Sequence GFPCGESCVYVPCLTAAIGCSCSNKVCYKN
Class Cyclotide
Technique EST
Average Mass 3093.59
Monoisotopic Mass 3091.28
m/z M+H 3093.59
ProteinType Wild type
Parent
Organism Oldenlandia affinis
Notes The sequence was predicted from an EST assembly.
Cyclic Yes

Assay
No assays found

References
Qin Q, McCallum EJ, Kaas Q, Suda J, Saska I, Craik DJ, Mylne JS. (2010) Identification of candidates for cyclotide biosynthesis and cyclisation by expressed sequence tag analysis of Oldenlandia affinis. BMC Genomics 11:111-0

Cross-references
Protein precursor(s) Kalata B19 precursor
Nucleic acids kalata B19 precursor [OaK5]
Structure
Links

Tools