psyle F(557) Protein Card

General Information
Name psyle F
Sequence GVIPCGESCVFIPCITAAVGCSCKNKVCYRD
Class Cyclotide
Average Mass 3212.80
Monoisotopic Mass 3210.43
m/z M+H 3211.43
ProteinType Wild type
Parent
Organism Psychotria leptothyrsa
Notes
Cyclic Yes

Assay
No assays found

References
Gerlach SL, Burman R, Bohlin L, Mondal D, Göransson U (2010) Isolation, characterization, and bioactivity of cyclotides from the Micronesian plant Psychotria leptothyrsa J Nat Prod 73:1207-1213

Cross-references
Nucleic acids
Structure
Links

Tools