psyle D(555) Protein Card

General Information
Name psyle D
Sequence GIPCGESCVFIPCTVTALLGCSCQNKVCYRD
Class Cyclotide
Average Mass 3256.81
Monoisotopic Mass 3254.41
m/z M+H 3255.42
ProteinType Wild type
Parent
Organism Psychotria leptothyrsa
Notes
Cyclic Yes

Assay
No assays found

References
Gerlach SL, Burman R, Bohlin L, Mondal D, Göransson U (2010) Isolation, characterization, and bioactivity of cyclotides from the Micronesian plant Psychotria leptothyrsa J Nat Prod 73:1207-1213

Cross-references
Nucleic acids
Structure
Links

Tools