Glopa E(541) Protein Card

General Information
Name Glopa E
Sequence GIPCAESCVWIPCTVTKMLGCSCKDKVCYN
Class Cyclotide
Technique MS,PcR
Average Mass 3228.86
Monoisotopic Mass 3226.39
m/z M+H 3228.86
ProteinType Wild type
Parent
Organism Viola odorata
Gloeospermum pauciflorum Hekking
Notes Glopa E was found in Gloeospermum pauciflorum Hekking by cDNA sequencing (Burman et al., 2010). It was identified at the peptide level in Viola ordorata leaf tissue (Aslam et al., 2021).
Cyclic Yes

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20
Aslam,L., Kaur,R., Sharma,V., Kapoor,N. and Mahajan,R. (2021) Isolation and characterization of cyclotides from the leaves of Viola odorata L. using peptidomic and bioinformatic approach. 3 Biotech 11:211-0

Cross-references
Protein precursor(s) Gpc2 precursor
Nucleic acids
Structure
Links

Tools