Glopa D(540) Protein Card

General Information
Name Glopa D
Sequence GVPCGESCVWVPCTVTALMGCSCVREVCRKD
Class Cyclotide
Technique PcR
Average Mass 3264.85
Monoisotopic Mass 3262.4
m/z M+H 3264.85
ProteinType Wild type
Parent
Organism Gloeospermum pauciflorum Hekking
Notes
Cyclic Yes

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Protein precursor(s) Gpc1 precursor
Nucleic acids
Structure
Links

Tools