Globa E(538) Protein Card

General Information
Name Globa E
Sequence GSAFGCGETCVKGKCNTPGCVCSWPVCKKN
Class Cyclotide
Technique PcR
Average Mass 3040.53
Monoisotopic Mass 3038.28
m/z M+H 3040.53
ProteinType Wild type
Parent
Organism Gloeospermum blakeanum (Standl.) Hekking
Notes
Cyclic Yes

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Protein precursor(s) Gbc4 precursor
Nucleic acids
Structure
Links

Tools