Gpc3 precursor(532) Protein Card

General Information
Name Gpc3 precursor
Sequence
AAFALPALAS
SFEKDVISFRAIQAVLEKRGLSKLEDDPVL
SALAHTKTIISN
PVIEEALLNGANLKAGN
GIPCAESCVWI
PCTVTALIGCGCSNKVCYN
SLQTKY
Class Cyclotide
Technique PcR
Average Mass 11067.87
Monoisotopic Mass 11060.72
m/z M+H 11061.73
ProteinType Precursor
Parent
Organism Gloeospermum pauciflorum Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains vibi E (356)
Nucleic acids Gpc2
Structure
Links

Tools