Gpc3 precursor(532) Protein Card

General Information
Name Gpc3 precursor
Sequence
AAFALPALAS
SFEKDVISFRAIQAVLEKRGLSKLEDDPVL
SALAHTKTIISN
PVIEEALLNGANLKAGN
GIPCAESCVWI
PCTVTALIGCGCSNKVCYN
SLQTKY
Class Cyclotide
Technique PcR
ProteinType Precursor
Parent
Organism Gloeospermum pauciflorum Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains vibi E (356)
Nucleic acids Gpc2
Structure
Links

Tools