Gpc4 precursor(530) Protein Card

General Information
Name Gpc4 precursor
Sequence
AAFALPALAT
FEKDVITPETIQAVLKRTAPLSNIMLEGDA
ISALITGKTVISK
TVLEEVFLNNGISDGVN
GVIPCGESCV
FIPCISAVLGCSCKSKVCYRN
SLVN
Class Cyclotide
Technique PcR
Average Mass 10974.88
Monoisotopic Mass 10967.72
m/z M+H 10968.73
ProteinType Precursor
Parent
Organism Gloeospermum pauciflorum Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains Globa B (535)
Nucleic acids Gpc4
Structure
Links SwissProt D2WPL0

Tools