cycloviolacin O3(53) Protein Card

General Information
Name cycloviolacin O3
Alternative name(s) CyO3
Sequence GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
Class Cyclotide
Technique MS,EST
Average Mass 3154.72
Monoisotopic Mass 3152.38
m/z M+H 3154.72
ProteinType Wild type
Parent
Organism Viola odorata
Viola uliginosa
Notes
Cyclic Yes

Assay
Nematocidal
A range of natural variants were selected based on net charge and/or hydrophobicity and were tested alongside the prototypic cyclotide kB1 in larval development assays with H. contortus and T. colubriformis. [...]Colgrave ML et al. (2008) Chembiochem 9:1939-1945
Insecticidal
CyO2,CyO3,CyO13,CyO19 have deterrent activity on M.persicae. [...]Dancewicz et al. (2020) Journal of Insect Physiology 122:104025-0

References
Craik DJ, Daly NL, Bond T, Waine C (1999) Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif. J Mol Biol 294:1327-36
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12
Slazak, B., Kapusta, M., Strömstedt, A.A., Słomka, A., Krychowiak, M., Shariatgorji, M., Andrén, P.E., Bohdanowicz, J., Kuta, E. and Göransson, U. (2018) How Does the Sweet Violet (Viola odorata L.) Fight Pathogens and Pests - Cyclotides as a Comprehensive Plant Host Defense System Frontiers in plant science 9:0-0
Slazak, B., Jacobsson, E., Kuta, E. and Göransson, U. (2015) Exogenous plant hormones and cyclotide expression in Viola uliginosa (Violaceae Phytochemistry 117:527-536
Dancewicz, K., Slazak, B., Kiełkiewicz, M., Kapusta, M., Bohdanowicz, J. and Gabryś, B. (2020) Behavioral and physiological effects of Viola spp. cyclotides on Myzus persicae (Sulz.) Journal of Insect Physiology 122:104025-0

Cross-references
Nucleic acids
Structure
Links GenBank P58435.1
SwissProt P58435

3D models Download or view with Jmol

Tools