cycloviolacin O3(53) Protein Card

General Information
Name cycloviolacin O3
Sequence GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
Class Cyclotide
Average Mass 3154.72
Monoisotopic Mass 3152.38
m/z M+H 3153.39
ProteinType Wild type
Parent
Organism Viola odorata
Notes
Cyclic Yes

Assay
Nematocidal
A range of natural variants were selected based on net charge and/or hydrophobicity and were tested alongside the prototypic cyclotide kB1 in larval development assays with H. contortus and T. colubriformis. [...]Colgrave ML et al. (2008) Chembiochem 9:1939-1945

References
Craik DJ, Daly NL, Bond T, Waine C (1999) Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif. J Mol Biol 294:1327-36
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12

Cross-references
Nucleic acids
Structure
Links GenBank P58435.1
SwissProt P58435

3D models Download or view with Jmol

Tools