Gbc4 precursor(528) Protein Card

General Information
Name Gbc4 precursor
Sequence
AAFALPALAA
YEIKDVITRDAYEALLKRKTAPLSSVMLEE
ELIMDKTVISN
PVLEEALLLYAQNKGLG
GSAFGCGETCVK
GKCNTPGCVCSWPVCKKN
SLIN
Class Cyclotide
Technique PcR
Average Mass 10908.80
Monoisotopic Mass 10901.6
m/z M+H 10902.6
ProteinType Precursor
Parent
Organism Gloeospermum blakeanum (Standl.) Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains Globa E (538)
Nucleic acids Gbc4
Structure
Links

Tools