Gbc6 precursor(527) Protein Card

General Information
Name Gbc6 precursor
Sequence
AAFALPALAT
FEKDVITPETIQAVLKRTAPLSNIMLEGDA
INALITGKTVISK
TVLEEALLKNDGLG
GVIPCGESCVFIP
CISSVLGCSCKNKVCYRN
SLVN
Class Cyclotide
Technique PcR
ProteinType Precursor
Parent
Organism Gloeospermum blakeanum (Standl.) Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains Mra23 (407)
Nucleic acids Gbc6
Structure
Links

Tools