Gbc6 precursor(527) Protein Card

General Information
Name Gbc6 precursor
Sequence
AAFALPALAT
FEKDVITPETIQAVLKRTAPLSNIMLEGDA
INALITGKTVISK
TVLEEALLKNDGLG
GVIPCGESCVFIP
CISSVLGCSCKNKVCYRN
SLVN
Class Cyclotide
Technique PcR
Average Mass 10696.62
Monoisotopic Mass 10689.63
m/z M+H 10690.64
ProteinType Precursor
Parent
Organism Gloeospermum blakeanum (Standl.) Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains Mra23 (407)
Nucleic acids Gbc6
Structure
Links

Tools