Gbc3precursor(526) Protein Card

General Information
Name Gbc3precursor
Sequence
AAFALPALAT
FERDVITPETIQAVLKMTNPNSNVMLEEDA
INALTGKTVISK
TVLEEALLNNANYGISDGFN
GIPCGETC
VFMPCISGPMGCSCKHMVCYRN
SLVN
Class Cyclotide
Technique PcR
Average Mass 11316.10
Monoisotopic Mass 11308.49
m/z M+H 11309.5
ProteinType Precursor
Parent
Organism Gloeospermum blakeanum (Standl.) Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains Globa D (536)
Nucleic acids Gbc3
Structure
Links

Tools