Gbc1 precursor(524) Protein Card

General Information
Name Gbc1 precursor
Sequence
AAFALPALAT
FEKDVITPEAIHAVLKRTAPLSNIMLEGDA
INALITGKTVISK
TVLEEAFLNNGISGGVN
GIPCGESCVF
IPCITAAIGCSCKTKVCYRN
SLIN
Class Cyclotide
Technique PcR
Average Mass 10809.69
Monoisotopic Mass 10802.63
m/z M+H 10803.64
ProteinType Precursor
Parent
Organism Gloeospermum blakeanum (Standl.) Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains Globa A (534)
Nucleic acids Gbc1
Structure
Links

Tools