Gbc1 precursor(524) Protein Card

General Information
Name Gbc1 precursor
Sequence
AAFALPALAT
FEKDVITPEAIHAVLKRTAPLSNIMLEGDA
INALITGKTVISK
TVLEEAFLNNGISGGVN
GIPCGESCVF
IPCITAAIGCSCKTKVCYRN
SLIN
Class Cyclotide
Technique PcR
ProteinType Precursor
Parent
Organism Gloeospermum blakeanum (Standl.) Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains Globa A (534)
Nucleic acids Gbc1
Structure
Links

Tools