Gbc5 precursor(523) Protein Card

General Information
Name Gbc5 precursor
Sequence
AAFALPAIAT
YEKDVITPAAIQLILKKTSPLMLEEDAINA
LLKSKTVISS
TVFEEALLKNSNNGVG
GSFPCGESCVFIPC
ISAIAGCSCKNKVCYKN
SLVN
Class Cyclotide
Technique PcR
ProteinType Precursor
Parent
Organism Gloeospermum blakeanum (Standl.) Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains Globa F (533)
Nucleic acids Gbc5
Structure
Links

Tools