Gbc5 precursor(523) Protein Card

General Information
Name Gbc5 precursor
Sequence
AAFALPAIAT
YEKDVITPAAIQLILKKTSPLMLEEDAINA
LLKSKTVISS
TVFEEALLKNSNNGVG
GSFPCGESCVFIPC
ISAIAGCSCKNKVCYKN
SLVN
Class Cyclotide
Technique PcR
Average Mass 10612.45
Monoisotopic Mass 10605.49
m/z M+H 10606.5
ProteinType Precursor
Parent
Organism Gloeospermum blakeanum (Standl.) Hekking
Notes
Cyclic No

Assay
No assays found

References
Burman R, Gruber CW, Rizzardi K, Herrmann A, Craik DJ, Gupta MP, Göransson U (2010) Cyclotide proteins and precursors from the genus Gloeospermum: filling a blank spot in the cyclotide map of Violaceae. Phytochemistry 71:13-20

Cross-references
Domains Globa F (533)
Nucleic acids Gbc5
Structure
Links

Tools