cycloviolacin O4(52) Protein Card

General Information
Name cycloviolacin O4
Alternative name(s) cO4,CyO4
Sequence GIPCGESCVWIPCISSAIGCSCKNKVCYRN
Class Cyclotide
Technique MS
Average Mass 3167.72
Monoisotopic Mass 3165.38
m/z M+H 3167.72
ProteinType Wild type
Parent
Organism Viola odorata
Viola tricolor
Pombalia calceolaria
Notes Hellinger et al. identified a possible deamination of Asparagine or Glutamine residues. The sequence was identified after trypsin/endoproteinase GluC double digest. IC50 of 9.8 μM against MDA-MB-231 breast cancer cell line (Pinto 2018)
Cyclic Yes

Assay
No assays found

References
Craik DJ, Daly NL, Bond T, Waine C (1999) Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif. J Mol Biol 294:1327-36
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12
Colgrave ML, Poth AG, Kaas Q, Craik DJ (2010) A new ‘era’ for cyclotide sequencing. Biopolymers: Peptide Science 94:592-601
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862
Pinto,M.E.F., Najas,J.Z.G., Magalhães,L.G., Bobey,A.F., Mendonça,J.N., Lopes,N.P., Leme,F.M., Teixeira,S.P., Trovó,M., Andricopulo,A.D., Koehbach,J., Gruber,C.W., Cilli,E.M. and Bolzani,V.S. (2018) Inhibition of Breast Cancer Cell Migration by Cyclotides Isolated from Pombalia calceolaria. J. Nat. Prod. 81:1203-1208

Cross-references
Nucleic acids
Structure
Links GenBank P58436.2
SwissProt P58436

3D models Download or view with Jmol

Tools