cycloviolacin O4(52) Protein Card

General Information
Name cycloviolacin O4
Alternative name(s) cO4
Sequence GIPCGESCVWIPCISSAIGCSCKNKVCYRN
Class Cyclotide
Technique MS
Average Mass 3167.72
Monoisotopic Mass 3165.38
m/z M+H 3167.72
ProteinType Wild type
Parent
Organism Viola odorata
Viola tricolor
Notes Hellinger et al. identified a possible deamination of Asparagine or Glutamine residues. The sequence was identified after trypsin/endoproteinase GluC double digest.
Cyclic Yes

Assay
No assays found

References
Craik DJ, Daly NL, Bond T, Waine C (1999) Plant cyclotides: A unique family of cyclic and knotted proteins that defines the cyclic cystine knot structural motif. J Mol Biol 294:1327-36
Ireland DC, Colgrave ML, Craik DJ (2006) A novel suite of cyclotides from Viola odorata: sequence variation and the implications for structure, function and stability. Biochem J. 400:1-12
Hellinger,R., Koehbach,J., Soltis,D.E., Carpenter,E.J., Wong,G.K. and Gruber,C.W. (2015) Peptidomics of Circular Cysteine-Rich Plant Peptides: Analysis of the Diversity of Cyclotides from Viola tricolor by Transcriptome and Proteome Mining. J. Proteome Res. 14:4851-4862

Cross-references
Nucleic acids
Structure
Links GenBank P58436.2
SwissProt P58436

3D models Download or view with Jmol

Tools