cO27(517) Protein Card

General Information
Name cO27
Sequence GSIPACGESCFKGWCYTPGCSCSKYPLCAKD
Class Cyclotide
Average Mass 3238.71
Monoisotopic Mass 3236.3
m/z M+H 3237.31
ProteinType Wild type
Parent
Organism Viola odorata
Notes
Cyclic Yes

Assay
No assays found

References
Colgrave ML, Poth AG, Kaas Q, Craik DJ (2010) A new ‘era’ for cyclotide sequencing. Biopolymers: Peptide Science 94:592-601

Cross-references
Nucleic acids
Structure
Links

Tools