cO29(514) Protein Card

General Information
Name cO29
Alternative name(s) Vo3079
Sequence GIPCGESCVWIPCISGAIGCSCKSKVCYKN
Class Cyclotide
Average Mass 3082.65
Monoisotopic Mass 3080.35
m/z M+H 3081.36
ProteinType Wild type
Parent
Organism Viola odorata
Notes
Cyclic Yes

Assay
No assays found

References
Colgrave ML, Poth AG, Kaas Q, Craik DJ (2010) A new ‘era’ for cyclotide sequencing. Biopolymers: Peptide Science 94:592-601

Cross-references
Nucleic acids
Structure
Links

Tools