palicourein(5) Protein Card

General Information
Name palicourein
Sequence GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN
Class Cyclotide
Average Mass 3904.37
Monoisotopic Mass 3901.64
m/z M+H 3902.65
ProteinType Wild type
Parent
Organism Palicourea condensata
Notes
Cyclic Yes

Assay
Anti-HIV
Palicourein shown to have anti-HIV properties. [...]Bokesch HR et al. (2001) J Nat Prod 64:249-50
NOE Restraint
NOE restraints for 1R1F [...]
Chemical Shift
Chemical shift data for palicourein [...]

References
Barry DG, Daly NL, Bokesch HR, Gustafson KR, Craik DJ (2004) Solution structure of the cyclotide palicourein: implications for the development of a pharmaceutical framework. Structure (Camb) 12:85-94
Bokesch HR, Pannell LK, Cochran PK, Sowder RC 2nd, McKee TC, Boyd MR (2001) A novel anti-HIV macrocyclic peptide from Palicourea condensata. J Nat Prod 64:249-50

Cross-references
Nucleic acids
Structure Solution Structure of the Cylcotide Palicourein: Implications for the development of pharmaceutical and agricultural applications
Links GenBank P84645.1
SwissProt P84645

Tools